DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EWSR1 and TIF35

DIOPT Version :9

Sequence 1:XP_011528297.1 Gene:EWSR1 / 2130 HGNCID:3508 Length:670 Species:Homo sapiens
Sequence 2:NP_010717.1 Gene:TIF35 / 852039 SGDID:S000002837 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:35/175 - (20%)
Similarity:64/175 - (36%) Gaps:53/175 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   295 MSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPV------ 353
            :|..::.....||.:.....:.|:.||.|.:           ||         ...||.      
Yeast   130 LSALEDPATNEGGVEAASEEKAGQVGGAGSI-----------PG---------QYVPPSRRAGAR 174

Human   354 DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQ--------------PMIHIYLD 404
            ||..|:         ..||...||:...    .::::|:...:              |.:.:..:
Yeast   175 DPSSDA---------YRDSRERDDMCTL----KIMQVNENADENSLREELLFPFAPIPRVSVVRN 226

Human   405 KETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKK 449
            |||||.:|.|.|::.....|:.|:.:.||:.:....|:|..::.|
Yeast   227 KETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EWSR1XP_011528297.1 RRM <351..>459 CDD:223796 26/119 (22%)
RRM_EWS 362..445 CDD:240977 20/96 (21%)
zf-RanBP 519..561 CDD:279035
RanBP2-type Zn finger 523..557 CDD:275375
TIF35NP_010717.1 eIF3g 6..127 CDD:403535
RRM_eIF3G_like 192..268 CDD:409842 16/79 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.