DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EWSR1 and tif35

DIOPT Version :9

Sequence 1:XP_011528297.1 Gene:EWSR1 / 2130 HGNCID:3508 Length:670 Species:Homo sapiens
Sequence 2:NP_595727.1 Gene:tif35 / 2540819 PomBaseID:SPBC18H10.03 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:34/124 - (27%)
Similarity:58/124 - (46%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   326 GSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKM 390
            |:.||:|.:..|  .:..|...:.|..:...|..|::.:.|..|:|....::|.|.|::.|    
pombe   168 GALGEKGRYIAP--HLRAGSGRESGDSMFKRERDDSATLRVTNLSDDTREEELRDLFRRFG---- 226

Human   391 NKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKK 449
                |...:::..|||||:.||.|.|||.|...|..|.:..||..:....|:...::.:
pombe   227 ----GIQRVYLAKDKETGRAKGFAFVSYYDRDCAIKARDRLDGYGWNNLILRCEFSKPR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EWSR1XP_011528297.1 RRM <351..>459 CDD:223796 27/99 (27%)
RRM_EWS 362..445 CDD:240977 25/82 (30%)
zf-RanBP 519..561 CDD:279035
RanBP2-type Zn finger 523..557 CDD:275375
tif35NP_595727.1 eIF3g 26..148 CDD:289149
RRM <191..>282 CDD:223796 27/99 (27%)
RRM_eIF3G_like 203..279 CDD:240854 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.