DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EWSR1 and gar1

DIOPT Version :9

Sequence 1:XP_011528297.1 Gene:EWSR1 / 2130 HGNCID:3508 Length:670 Species:Homo sapiens
Sequence 2:NP_596365.1 Gene:gar1 / 2540705 PomBaseID:SPBC20F10.01 Length:194 Species:Schizosaccharomyces pombe


Alignment Length:333 Identity:86/333 - (25%)
Similarity:110/333 - (33%) Gaps:163/333 - (48%)


- Green bases have known domain annotations that are detailed below.


Human   315 RGGRGGG-RGGMGSAGERGGFN--KPGGPMDEGPDLDL------GPPVDPDEDSD----NSAIYV 366
            ||||||| |||      |||..  .|.||.|:..:|.|      |..|....:..    |:.||:
pombe     4 RGGRGGGFRGG------RGGSRPFTPSGPPDQVIELGLFMHDCEGEMVCQSTNVKIPYFNAPIYL 62

Human   367 QGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKP-KGDATVSYEDPPTAKAAVEW 430
            :..:....:|::..                ||..:|.   |.|| :|..:.|::           
pombe    63 ENKSQIGKIDEVFG----------------PMNQVYF---TVKPSEGIVSSSFK----------- 97

Human   431 FDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDR 495
                  .|.|:.:| ..|..|::           |.:|.|...|                     
pombe    98 ------VGDKVYLS-GDKLIPLD-----------RFLPKPKTVG--------------------- 123

Human   496 GGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPSIGDFCCDVIVCRGCGNQNFAWRTECNQCKAP 560
                |:.|:|:|..|:                                                 
pombe   124 ----PKKPKGARNGPA------------------------------------------------- 135

Human   561 KPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGG-RGGDRGGFRGG-RGMDRGG 623
                             ||||.||.||||||  .|||.||..||| .||.||||.|| ||..|||
pombe   136 -----------------GRGGRGGFRGGRGG--SRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGG 181

Human   624 FGGGRRGG 631
            |.||.|||
pombe   182 FRGGSRGG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EWSR1XP_011528297.1 RRM <351..>459 CDD:223796 18/112 (16%)
RRM_EWS 362..445 CDD:240977 13/83 (16%)
zf-RanBP 519..561 CDD:279035 0/41 (0%)
RanBP2-type Zn finger 523..557 CDD:275375 0/33 (0%)
gar1NP_596365.1 Gar1 20..>128 CDD:282290 30/180 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.