DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EWSR1 and uap2

DIOPT Version :9

Sequence 1:XP_011528297.1 Gene:EWSR1 / 2130 HGNCID:3508 Length:670 Species:Homo sapiens
Sequence 2:NP_596826.1 Gene:uap2 / 2539783 PomBaseID:SPBC1289.02c Length:367 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:39/105 - (37%)
Similarity:59/105 - (56%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   361 NSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAK 425
            |.|:|:|||...||:|::.:.||:|||:..|...|.|.|.|| ..|.|.|||||.:.:....:.:
pombe   109 NKAVYIQGLPLDVTVDEIEEVFKKCGVIAKNIDNGTPRIKIY-RTEDGTPKGDALIVFFRSESVE 172

Human   426 AAVEWFDGKDFQ---GSKLKVSLA----RKKPPMNSMRGG 458
            .|.:.||..:|:   |.|::|..|    :|:..:|...||
pombe   173 LAEQLFDDTEFRYGSGQKMRVQKANIDYKKEKTVNKDVGG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EWSR1XP_011528297.1 RRM <351..>459 CDD:223796 39/105 (37%)
RRM_EWS 362..445 CDD:240977 33/85 (39%)
zf-RanBP 519..561 CDD:279035
RanBP2-type Zn finger 523..557 CDD:275375
uap2NP_596826.1 RRM 1..>220 CDD:223796 39/105 (37%)
RRM1_TatSF1_like 109..202 CDD:240727 35/93 (38%)
RRM3_RBM39_like 249..333 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.