DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MECOM and sfc2

DIOPT Version :9

Sequence 1:XP_005247270.1 Gene:MECOM / 2122 HGNCID:3498 Length:1240 Species:Homo sapiens
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:256 Identity:74/256 - (28%)
Similarity:108/256 - (42%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   206 ERQYRCE--DCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLQ---EIH----- 260
            ||.:.|:  .|.:.|..|:.|..|::  |.|....||...:....:..::..|:   |:|     
pombe    50 ERPFVCDYTGCSKAFYRKSHLKIHKR--CHTNVKPFSCHYDGCDAQFYTQQHLERHIEVHRKPKP 112

Human   261 ---TIQECKECDQVFPDLQSLEKHMLS-HTEEREYKC--DQCPKAFNWKSNLIRH-QMSHDSGKH 318
               |.:.|.||   |...|.|..|:.: ||....|.|  ..|...|..|..|..| ..:|:....
pombe   113 YACTWEGCDEC---FSKHQQLRSHISACHTHLLPYPCTYQDCELRFATKQKLQNHVNRAHEKIIS 174

Human   319 YEC--ENC-AKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSV----KP 376
            |.|  |:| ..:.|...|.||.|||..||    .:|..||:.|.|::.|:.|..:|.:.    |.
pombe   175 YSCPHESCVGHEGFEKWSQLQNHIREAHV----PSCSICGRQFKTAAHLRHHVVLHQTTLEERKT 235

Human   377 FIC--EVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKH--RRFCEGKNH 433
            :.|  |.|.||:|:.|.|.:|..:..:......|..||..|.....|.:|  |..|: |.|
pombe   236 YHCPMEGCKKSFTRSSALKKHISVIHEGNMAFHCDSCGTKFGYKHMLQRHLERGTCK-KAH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MECOMXP_005247270.1 PR-SET_PRDM3 47..204 CDD:380991
C2H2 Zn finger 211..260 CDD:275368 12/53 (23%)
C2H2 Zn finger 265..285 CDD:275368 7/20 (35%)
zf-H2C2_2 277..301 CDD:372612 7/26 (27%)
zf-C2H2 291..313 CDD:333835 7/24 (29%)
C2H2 Zn finger 293..313 CDD:275368 6/22 (27%)
C2H2 Zn finger 321..343 CDD:275368 10/24 (42%)
zf-H2C2_2 334..360 CDD:372612 11/25 (44%)
zf-C2H2 349..371 CDD:333835 7/21 (33%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 377..399 CDD:333835 9/23 (39%)
C2H2 Zn finger 379..399 CDD:275368 9/21 (43%)
C2H2 Zn finger 408..426 CDD:275368 6/19 (32%)
zf-C2H2 922..944 CDD:333835
C2H2 Zn finger 924..944 CDD:275368
zf-H2C2_2 936..960 CDD:372612
C2H2 Zn finger 952..973 CDD:275368
zf-H2C2_2 964..990 CDD:372612
C2H2 Zn finger 981..1001 CDD:275368
sfc2NP_594670.1 COG5048 1..374 CDD:227381 74/256 (29%)
C2H2 Zn finger 28..47 CDD:275368
C2H2 Zn finger 55..77 CDD:275368 6/23 (26%)
C2H2 Zn finger 85..107 CDD:275368 2/21 (10%)
C2H2 Zn finger 115..138 CDD:275368 8/25 (32%)
C2H2 Zn finger 146..165 CDD:275368 5/18 (28%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
C2H2 Zn finger 238..261 CDD:275368 9/22 (41%)
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.