DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV5 and Ets65A

DIOPT Version :9

Sequence 1:NP_004445.1 Gene:ETV5 / 2119 HGNCID:3494 Length:510 Species:Homo sapiens
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:212 Identity:80/212 - (37%)
Similarity:107/212 - (50%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   310 SSYMR--GGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEP-TMYREGPPYQR------- 364
            |||..  |.:.|:..:|:|                ....| :|.:| :..|:..|||.       
  Fly   261 SSYKSSWGSHSSTQSQGYS----------------SNALG-IKHDPHSQLRQPDPYQMFGPTSSR 308

Human   365 -----RGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSR 424
                 .|.:||||||:.||.|..||..|.|.|...||||.:|:|||||||.:|::|.||||||||
  Fly   309 LASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 373

Human   425 SLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSE-EDTLPLTHFED 488
            :|||||:|.||.||.|:||.|||  |...|.:...|....|..|.:|:..::. ..:..|:.|. 
  Fly   374 ALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSSFM- 435

Human   489 SPAYLLDMDRCSSLPYA 505
            ||.:.:.....|..|.|
  Fly   436 SPHHGMTSSSASIFPSA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV5NP_004445.1 ETS_PEA3_N 2..366 CDD:309665 14/70 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..208
ETS 367..452 CDD:197710 53/84 (63%)
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 53/86 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.