DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV5 and ets-7

DIOPT Version :10

Sequence 1:NP_004445.1 Gene:ETV5 / 2119 HGNCID:3494 Length:510 Species:Homo sapiens
Sequence 2:NP_504947.2 Gene:ets-7 / 184687 WormBaseID:WBGene00017601 Length:218 Species:Caenorhabditis elegans


Alignment Length:136 Identity:45/136 - (33%)
Similarity:69/136 - (50%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   366 GSLQLWQFLVTLLDDPANAHFIAWTGRG-MEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYY 429
            |..:|..||..||:|.:::..|.|:.:. :||::::|.:||..||.....|.|||||:||.|||:
 Worm    10 GKQRLLNFLRGLLEDDSHSDLITWSNKDTLEFQMLKPHKVAELWGAATGNPGMNYDKMSRGLRYF 74

Human   430 YEKGIMQKVAGERYVYKFVCDPDALFSMAFPD---------NQRPFLKAESECHLSEEDTLPLTH 485
            |....::||.|:...|.|:   |......|||         .:.|....|:....|||.|...: 
 Worm    75 YTNNTLKKVKGKDSRYCFL---DTPLLAPFPDFFPKANEPMRRVPLFSIENLLASSEETTSNFS- 135

Human   486 FEDSPA 491
            .:.||:
 Worm   136 LQSSPS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV5NP_004445.1 ETS_PEA3_N 1..366 CDD:461371 45/136 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..208
ETS 367..452 CDD:197710 32/85 (38%)
ets-7NP_504947.2 Ets 13..92 CDD:459700 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.