DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV5 and ets-8

DIOPT Version :10

Sequence 1:NP_004445.1 Gene:ETV5 / 2119 HGNCID:3494 Length:510 Species:Homo sapiens
Sequence 2:NP_500046.2 Gene:ets-8 / 183631 WormBaseID:WBGene00016798 Length:141 Species:Caenorhabditis elegans


Alignment Length:82 Identity:33/82 - (40%)
Similarity:55/82 - (67%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   370 LWQFLVTLLDDPANAHFIAWTGR-GMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKG 433
            |:|.::...:|...|..|.||.: .:||::::.:||||.||.:|....|:|:.||||:|.||:.|
 Worm    32 LFQMILKSENDKNVAKIIKWTKKSSLEFQMVDRQEVARLWGAEKGNLKMDYEFLSRSIRSYYKSG 96

Human   434 IMQKVAGERYVYKFVCD 450
            ||:|:.|:.:.|:|:.|
 Worm    97 IMRKIPGKDFRYQFIAD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV5NP_004445.1 ETS_PEA3_N 1..366 CDD:461371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..208
ETS 367..452 CDD:197710 33/82 (40%)
ets-8NP_500046.2 ETS 25..115 CDD:197710 33/82 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.