DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV4 and ets-7

DIOPT Version :10

Sequence 1:NP_001977.1 Gene:ETV4 / 2118 HGNCID:3493 Length:484 Species:Homo sapiens
Sequence 2:NP_504947.2 Gene:ets-7 / 184687 WormBaseID:WBGene00017601 Length:218 Species:Caenorhabditis elegans


Alignment Length:132 Identity:46/132 - (34%)
Similarity:69/132 - (52%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   339 GALQLWQFLVALLDDPTNAHFIAWTGRG-MEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYY 402
            |..:|..||..||:|.:::..|.|:.:. :||::::|.:||.|||.....|.|||||:||.|||:
 Worm    10 GKQRLLNFLRGLLEDDSHSDLITWSNKDTLEFQMLKPHKVAELWGAATGNPGMNYDKMSRGLRYF 74

Human   403 YEKGIMQKVAGERYVYKFVCEP-EALFSLAFPDNQRPALKAEF----DRPVSEEDTVPLSHLDES 462
            |....::||.|:...|.|:..| .|.|...||....|..:...    :...|.|:|.....|..|
 Worm    75 YTNNTLKKVKGKDSRYCFLDTPLLAPFPDFFPKANEPMRRVPLFSIENLLASSEETTSNFSLQSS 139

Human   463 PA 464
            |:
 Worm   140 PS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV4NP_001977.1 ETS_PEA3_N 8..339 CDD:461371 46/132 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..115
ETS 341..424 CDD:197710 33/83 (40%)
ets-7NP_504947.2 Ets 13..92 CDD:459700 32/78 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.