DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV4 and ets-8

DIOPT Version :10

Sequence 1:NP_001977.1 Gene:ETV4 / 2118 HGNCID:3493 Length:484 Species:Homo sapiens
Sequence 2:NP_500046.2 Gene:ets-8 / 183631 WormBaseID:WBGene00016798 Length:141 Species:Caenorhabditis elegans


Alignment Length:82 Identity:33/82 - (40%)
Similarity:56/82 - (68%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   343 LWQFLVALLDDPTNAHFIAWTGR-GMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKG 406
            |:|.::...:|...|..|.||.: .:||::::.:|||||||.:|....|:|:.||||:|.||:.|
 Worm    32 LFQMILKSENDKNVAKIIKWTKKSSLEFQMVDRQEVARLWGAEKGNLKMDYEFLSRSIRSYYKSG 96

Human   407 IMQKVAGERYVYKFVCE 423
            ||:|:.|:.:.|:|:.:
 Worm    97 IMRKIPGKDFRYQFIAD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV4NP_001977.1 ETS_PEA3_N 8..339 CDD:461371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..115
ETS 341..424 CDD:197710 33/82 (40%)
ets-8NP_500046.2 ETS 25..115 CDD:197710 33/82 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.