DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV3 and Ets97D

DIOPT Version :10

Sequence 1:NP_001138784.1 Gene:ETV3 / 2117 HGNCID:3492 Length:512 Species:Homo sapiens
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:102 Identity:53/102 - (51%)
Similarity:67/102 - (65%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    24 YKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYD 88
            |.|..|..:.|:|||.|:||:|...|...||.| .|..|||.:.|||.||||||.:|.||.|||:
  Fly   335 YTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEW-VGTEGEFKLTDPDRVARLWGEKKNKPAMNYE 398

Human    89 KLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNY 125
            ||||||||||:..::.|..||||.|||:.:..::..|
  Fly   399 KLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGY 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV3NP_001138784.1 ETS 34..120 CDD:197710 49/85 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..512
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:463311
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 49/84 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.