DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETV2 and Ets97D

DIOPT Version :9

Sequence 1:XP_005258709.1 Gene:ETV2 / 2116 HGNCID:3491 Length:370 Species:Homo sapiens
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:158 Identity:65/158 - (41%)
Similarity:86/158 - (54%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   213 PAGPDCTTSWNPGLHAGGTTSL------KRYQSSALTVCSEPSPQSDRASLARCPKT----NHRG 267
            |..|...::.:...::||:.||      |.|||    |.|..|.:|..:|:.....|    .:.|
  Fly   284 PKQPRIMSANSISTNSGGSLSLEQRIMRKSYQS----VKSSDSVESTTSSMNPSNYTTIGSGNNG 344

Human   268 PIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYR 332
            .:||||||||:|.|...:..|.|.|...||:|.||..|||||||:|.||.||||||||.|||||.
  Fly   345 QVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYD 409

Human   333 RDIVRKSGGRKYTYRFGGRVPSLAYPDC 360
            .|::.|..|:::.|:|          ||
  Fly   410 GDMISKVSGKRFAYKF----------DC 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETV2XP_005258709.1 ETS 268..350 CDD:197710 46/81 (57%)
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 48/93 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.