DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS2 and Ets96B

DIOPT Version :9

Sequence 1:NP_001243224.1 Gene:ETS2 / 2114 HGNCID:3489 Length:609 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:315 Identity:92/315 - (29%)
Similarity:137/315 - (43%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   304 EQMIKENQEKTEDQYEENSHLTSV-------PHWINSNTLGFGTEQAPYGMQTQ----------N 351
            :|..:|.|::.:.|.::..|...:       ||..:|:....|.:||.....|.          .
  Fly   326 QQQQQEQQQQQQQQQQQQQHQQQLQQAAALHPHHHHSHHGHHGHQQAEQQALTHLTPLHAASAFK 390

Human   352 YPKGGLLDSMCPASTPSVLSSEQEFQ-------MFPK--SRLSSVSVTY------CSVSQDFPGS 401
            :....::.|....:|||..:.:|:.|       :.|.  :.:|...:.|      .::|..:| |
  Fly   391 FSHTAVISSSAVYATPSHYAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYP-S 454

Human   402 NLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNK 466
            .|.....:|.|..|   .|...|.|.:|:.:..|.|.|:                          
  Fly   455 ALRPNVVDSTTSSD---AELRLDQFYASNGISTSSNGQA-------------------------- 490

Human   467 PTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQ-SFISWTGDGWE 530
                    |.:|                     .|.:||||||:.||.:.:.. |.|:|||.|.|
  Fly   491 --------ISQR---------------------RGSLQLWQFLVALLDEPTTSASCIAWTGRGME 526

Human   531 FKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD 585
            |||.:|:|||||||.:||:|.|||:||||.|||||:|.|:.|.:|:|||||||||
  Fly   527 FKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCD 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS2NP_001243224.1 GSK-3_bind <39..>143 CDD:283100
SAM_PNT-ETS-2 225..313 CDD:188884 3/8 (38%)
ETS 502..586 CDD:197710 54/85 (64%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 54/85 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.