DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS1 and Ets96B

DIOPT Version :10

Sequence 1:XP_047282481.1 Gene:ETS1 / 2113 HGNCID:3488 Length:502 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:183 Identity:78/183 - (42%)
Similarity:97/183 - (53%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   327 QSWSSQSSFNSLQRVPS----------------YDSFDSEDYPAAL-PNHKPKGTFKDYVRDRAD 374
            |...|||.:..|.  |:                |::..|..||:|| ||.....|..|     |:
  Fly   413 QQTQSQSVYRDLS--PTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSD-----AE 470

Human   375 LNKDKPVIPAAALAGYTGS------GPIQLWQFLLELL----TDKSCQSFISWTGDGWEFKLSDP 429
            |..|:............|.      |.:||||||:.||    |..||   |:|||.|.||||.:|
  Fly   471 LRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASC---IAWTGRGMEFKLIEP 532

Human   430 DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 482
            :|||||||.:||:|.|||:||||.|||||:|.|:.|..|:|||||||||..:|
  Fly   533 EEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDAL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS1XP_047282481.1 SAM_PNT-ETS-1 112..199 CDD:176092
Ets1_N_flank 208..395 CDD:466113 20/90 (22%)
ETS 395..479 CDD:197710 55/87 (63%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 56/88 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.