DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS1 and Ets96B

DIOPT Version :9

Sequence 1:NP_001137292.1 Gene:ETS1 / 2113 HGNCID:3488 Length:485 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:183 Identity:78/183 - (42%)
Similarity:97/183 - (53%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   310 QSWSSQSSFNSLQRVPS----------------YDSFDSEDYPAAL-PNHKPKGTFKDYVRDRAD 357
            |...|||.:..|.  |:                |::..|..||:|| ||.....|..|     |:
  Fly   413 QQTQSQSVYRDLS--PTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSD-----AE 470

Human   358 LNKDKPVIPAAALAGYTGS------GPIQLWQFLLELL----TDKSCQSFISWTGDGWEFKLSDP 412
            |..|:............|.      |.:||||||:.||    |..||   |:|||.|.||||.:|
  Fly   471 LRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASC---IAWTGRGMEFKLIEP 532

Human   413 DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 465
            :|||||||.:||:|.|||:||||.|||||:|.|:.|..|:|||||||||..:|
  Fly   533 EEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDAL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS1NP_001137292.1 SAM_PNT-ETS-1 95..182 CDD:176092
ETS 378..462 CDD:197710 55/87 (63%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 56/88 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.