DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS1 and Ets65A

DIOPT Version :9

Sequence 1:NP_001137292.1 Gene:ETS1 / 2113 HGNCID:3488 Length:485 Species:Homo sapiens
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:190 Identity:84/190 - (44%)
Similarity:100/190 - (52%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   283 GRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGT 347
            |..|....||...:.|.:|         ||.|.||..|    ..|.|      .|....|.|   
  Fly   247 GGASASGGGGSALYSSYKS---------SWGSHSSTQS----QGYSS------NALGIKHDP--- 289

Human   348 FKDYVRDRADLNKDKPVI---PAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKL 409
                   .:.|.:..|..   |.::....:|||.|||||||||||:|.:..|.|:|.|...||||
  Fly   290 -------HSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKL 347

Human   410 SDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 469
            :||||||||||:||:||.|||:||||.|||||||||:.|..||||.|:|  |.|.|...|
  Fly   348 TDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAAT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS1NP_001137292.1 SAM_PNT-ETS-1 95..182 CDD:176092
ETS 378..462 CDD:197710 57/83 (69%)
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 59/86 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.