DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS1 and edl

DIOPT Version :10

Sequence 1:XP_047282481.1 Gene:ETS1 / 2113 HGNCID:3488 Length:502 Species:Homo sapiens
Sequence 2:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster


Alignment Length:107 Identity:32/107 - (29%)
Similarity:44/107 - (41%) Gaps:31/107 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    95 VPLLTPSSKEMMSQALKATFSGFTKEQQRL-----------------GIPKDPRQWTETHVRDWV 142
            |.|::.||      |:.:|.:.......||                 |:|.|||.||...|  | 
  Fly    58 VTLISASS------AISSTSNSSDDNNNRLMSADDGTTSLLHPLGSDGLPLDPRDWTRADV--W- 113

Human   143 MWAVNEFSLKGVDF-----QKFCMNGAALCALGKDCFLELAP 179
            .|.:|....:|::.     |||.|||.|||.:..|.:|...|
  Fly   114 KWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS1XP_047282481.1 SAM_PNT-ETS-1 112..199 CDD:176092 27/90 (30%)
Ets1_N_flank 208..395 CDD:466113
ETS 395..479 CDD:197710
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086 22/56 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.