DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETS1 and aop

DIOPT Version :10

Sequence 1:XP_047282481.1 Gene:ETS1 / 2113 HGNCID:3488 Length:502 Species:Homo sapiens
Sequence 2:NP_523455.2 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster


Alignment Length:43 Identity:15/43 - (34%)
Similarity:18/43 - (41%) Gaps:9/43 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   314 LLLSMLLIGC-----CWQLCCVPPVEEL----PPPQPRPQPVK 347
            |....|.:||     ..|.||..|.|:.    |||.||.:..|
  Fly   167 LFTGTLTLGCKSYLDSQQRCCYCPPEKTEGSPPPPPPRQEQGK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETS1XP_047282481.1 SAM_PNT-ETS-1 112..199 CDD:176092
Ets1_N_flank 208..395 CDD:466113 15/43 (35%)
ETS 395..479 CDD:197710
aopNP_523455.2 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.