DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strap and wmd

DIOPT Version :10

Sequence 1:NP_035629.2 Gene:Strap / 20901 MGIID:1329037 Length:350 Species:Mus musculus
Sequence 2:NP_611804.1 Gene:wmd / 37727 FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster


Alignment Length:152 Identity:34/152 - (22%)
Similarity:62/152 - (40%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   140 RSRSPPHWRGS--RFIGRYRCRFSQSPRRSPRPYRSRSRSRERSIRLSLEEKKYLLNVAKANAAR 202
            |:|.||.:.|:  ||:.    :..||.....:.|...:...|.:::..:.:.|.||::.:||   
  Fly   674 RNRHPPQYDGAYRRFVE----QLQQSIAHIRKVYAETAYLSEAAVQEFIVQAKPLLDLEEAN--- 731

Mouse   203 ILGVQNLELPESLKEMEQQEERKRRSSSDEEERVRVDLAPQKTPAQVNGGGAADDEAETAQTSPK 267
                 |..|.|.|.|:.....|.:||            ||  .|:.|.|....:.:....::   
  Fly   732 -----NHALFEQLLELMDVSPRPKRS------------AP--APSMVGGATKLNTKLLLMES--- 774

Mouse   268 RKQIVFSNNNAIAKPSSSPTLS 289
               :..|.|.::|:.:.:..||
  Fly   775 ---LTVSKNVSVARQARTSLLS 793

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
StrapNP_035629.2 WD40 <4..294 CDD:441893 34/152 (22%)
WD 1 12..56
WD 2 57..96
WD 3 98..137