DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bhlhe40 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:171 Identity:36/171 - (21%)
Similarity:67/171 - (39%) Gaps:50/171 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    54 KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKI 118
            |:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..::   ..:.:||..:
  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR---KQVVKQQAPV 81

Mouse   119 IALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLA--------------KH---ENTRDL 166
            ..|.                .:.|.:|:.....|:.:.:|              .|   |..|.|
  Fly    82 SPLP----------------MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRML 130

Mouse   167 KSSQLVTHL--------------HRVVSELLQGGASRKPLD 193
            ::.|:.|.:              :...:|..|..||.||::
  Fly   131 QADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bhlhe40NP_035628.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250 1..139 20/84 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 20/74 (27%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 11/74 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..294
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/54 (31%)
ORANGE 87..131 CDD:128787 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.