DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aurkb and aurB

DIOPT Version :9

Sequence 1:NP_035626.1 Gene:Aurkb / 20877 MGIID:107168 Length:345 Species:Mus musculus
Sequence 2:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster


Alignment Length:264 Identity:132/264 - (50%)
Similarity:190/264 - (71%) Gaps:4/264 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    75 QPF--TIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHL 137
            ||:  :..:||:|..||:||||.||||||:.|.::||:|::||.::.|..|:.|:.||||||:.|
  Fly    44 QPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRL 108

Mouse   138 KHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQ--KSRTFDEQRTATIMEELSDALTYCHKKK 200
            |||:||:|..:|:|:.||||.||.|..|||:|.|:  .:..|||.|:|....::::||.|||...
  Fly   109 KHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNN 173

Mouse   201 VIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIG 265
            |||||:||||:||....:||:||||||.|.|:.:|:|:|||||||||||::|..:::.||.||:|
  Fly   174 VIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLG 238

Mouse   266 VLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKLLKHNPWQRLPLAEVAAHP 330
            :||||.:||.|||||.|...||.:|.::::.:||.:..|.::||..||:.....|:.|.:|..|.
  Fly   239 ILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHY 303

Mouse   331 WVRA 334
            ||:|
  Fly   304 WVKA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AurkbNP_035626.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..77 1/1 (100%)
PKc_like 77..344 CDD:304357 130/262 (50%)
S_TKc 82..332 CDD:214567 127/251 (51%)
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 128/253 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - LDO PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.