DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stau1 and loqs

DIOPT Version :9

Sequence 1:NP_001103376.1 Gene:Stau1 / 20853 MGIID:1338864 Length:495 Species:Mus musculus
Sequence 2:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster


Alignment Length:410 Identity:98/410 - (23%)
Similarity:155/410 - (37%) Gaps:117/410 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    95 KSEISQVFEIALKRNLPVNFESFLLTQVARESGPPHMKNFVTRVSVGE----FVGEGEGKSKKIS 155
            |:.:|.:.|:..:|.:...:|   |.|:   .|..|...|..|||..:    |...|.|:|||.:
  Fly   134 KTPVSILQELLSRRGITPGYE---LVQI---EGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEA 192

Mouse   156 KKNAARAVLEQL--RRLPPLPAVERVKPRIKKKSQPTCK-LQTAPDYGQGM-------------- 203
            |..||||::::|  .:||..|:         ..:.|:.. |..|...|.|.              
  Fly   193 KHAAARALIDKLIGAQLPESPS---------SSAGPSVTGLTVAGSGGDGNANATGGGDASDKTV 248

Mouse   204 -NPISRLAQIQQAKKEKEPEYMLLTERGLPRRREFVMQVKVGHHTAEGVGTNKKVAKRNAAENML 267
             |||..|.::...::...|.|...||.|||..|.|.:...:.::...|.|.:||:|||.||..|.
  Fly   249 GNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMW 313

Mouse   268 EILGFKVPQAQPAKPALKSEEKTPVKKPGDGRKVTFFEPSPGDENGTSNKDEEF-------RMPY 325
            ..|                 ::||:    |..|::  :...|:..|.....|.:       .:|.
  Fly   314 MRL-----------------QETPI----DSGKIS--DSICGELEGEPRSSENYYGELKDISVPT 355

Mouse   326 LSHQQLPAGILPMVPEVAQAVGVSQGHHT-KDFTRAAPNPAKATVTAMIARELLYGGTSPTAETI 389
            |:.|              .:..|||.|.| |:.|               .::||     ...:|.
  Fly   356 LTTQ--------------HSNKVSQFHKTLKNAT---------------GKKLL-----KLQKTC 386

Mouse   390 LKSNISSGHVPHGPRTRPSEQLYYLSRAQGFQVEYKDFPK---NNKNECVSLINCSSQPPLVSHG 451
            ||:|          :....:.|..::....|:|.|.|..:   :.:.:|  |:..|:.|..|.||
  Fly   387 LKNN----------KIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQC--LVQLSTLPVGVCHG 439

Mouse   452 IGKDVESCHDMAALNILKLL 471
            .|.........||.|.|:.|
  Fly   440 SGPTAADAQRHAAQNALEYL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stau1NP_001103376.1 DSRM 98..167 CDD:214634 23/72 (32%)
DSRM 204..270 CDD:238007 23/65 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..318 6/39 (15%)
Staufen_C 366..475 CDD:293091 24/109 (22%)
loqsNP_609646.1 DSRM 136..204 CDD:214634 23/73 (32%)
DSRM 250..316 CDD:238007 23/65 (35%)
DSRM 394..460 CDD:214634 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.