DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and gzl

DIOPT Version :9

Sequence 1:NP_035613.2 Gene:Znrf4 / 20834 MGIID:1341258 Length:327 Species:Mus musculus
Sequence 2:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:263 Identity:65/263 - (24%)
Similarity:104/263 - (39%) Gaps:66/263 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 DFLDLPALLGVPVDPKRARGYLLVA-RPADACHAIEGP----WPDNHSLDPLVLVRPLGCSWEQT 95
            :|.||||..|..:.....:.|::.| ||...|.:::.|    :|.:...  :.||....|.:|:.
  Fly    41 EFNDLPAQFGPNLPSNGLKVYVVPARRPYYGCDSLDRPPHLKYPPSAKF--VALVARGECVFERK 103

Mouse    96 GRRAQRAGATAASVGPEAPGQLREFEDLEVT-VRCDQPARVLLPHAEPCPDPECHPVVVASWALA 159
            .|.||.|..:|..|.......|.:.....:| :|.                    |.|.......
  Fly   104 IRVAQNASYSAVIVYNNEGDDLEQMSAENITGIRI--------------------PSVFVGHTTG 148

Mouse   160 RALALAASTLFVL------------RQLWPWVRGLGS--------------------RGTAVKTQ 192
            :|||...:|..||            :.:.|:...:|.                    |...:...
  Fly   149 KALATYFTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKS 213

Mouse   193 TCQKAQVRTFTRLS-----DLCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAAQRSCPLCK 252
            ..:|..|..:|:.:     |.|.|||:|:.|.::|::|||:|.||..|||||.:. .:|.||:||
  Fly   214 MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTE-NRRVCPICK 277

Mouse   253 QSV 255
            :.|
  Fly   278 RKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_035613.2 PA_C_RZF_like 19..156 CDD:239038 28/125 (22%)
zf-RING_2 207..252 CDD:290367 22/44 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..279 65/263 (25%)
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 34/151 (23%)
zf-RING_2 233..277 CDD:290367 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.