DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_035613.2 Gene:Znrf4 / 20834 MGIID:1341258 Length:327 Species:Mus musculus
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:51/274 - (18%)
Similarity:94/274 - (34%) Gaps:82/274 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    60 ARPADACHAIEGPWPDNHSLDPLVLVRPLGCSWEQTGRRAQRAGATAASVGPE------------ 112
            ::|:......:|....:.::...:||:...|::......|||.|.....||..            
pombe   122 SKPSARVQKDDGGESKDEAILDFLLVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMV 186

Mouse   113 APGQLRE------------------FEDLEVTVRCDQPARVLLPHAEP------------CPDPE 147
            ||.::.|                  :.||..:.|  ||.::   :|:|            |..|.
pombe   187 APDKVDESKVHIPSLFVSTSSYNLLWSDLLHSYR--QPLKL---YAKPEELGDMFWPFLLCFSPS 246

Mouse   148 CHPVVVASWALARALALAASTLFVLRQLWPWVRGLGSRGTAVKTQTCQKAQVRTFTRLSDL---- 208
               :::.....|.|:.....|.....:...::..|.||..:.:....::.::...|:..:|    
pombe   247 ---IIMLITVQALAIRKFIRTYRTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLM 308

Mouse   209 ------------CAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAAQRSCPLCKQSVASTHDG 261
                        |.|||:.:.:|:::..|||.|.:|..||..|.. ..:.:||.|...|      
pombe   309 DESTRRATFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIV-DYRHACPTCNTEV------ 366

Mouse   262 STDGSVGGEEPPLP 275
                     .||.|
pombe   367 ---------PPPKP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_035613.2 PA_C_RZF_like 19..156 CDD:239038 23/137 (17%)
zf-RING_2 207..252 CDD:290367 16/60 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..279 3/20 (15%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 48/270 (18%)
Peptidases_S8_S53 <144..211 CDD:299169 12/66 (18%)
zf-RING_2 320..362 CDD:290367 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2091
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.