DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and C18B12.4

DIOPT Version :9

Sequence 1:NP_035613.2 Gene:Znrf4 / 20834 MGIID:1341258 Length:327 Species:Mus musculus
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:306 Identity:80/306 - (26%)
Similarity:118/306 - (38%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    45 GVPVDPKRARGYLLVAR-PADACH---------AIEGPWPDNH-------SLDPLVLV------- 85
            ||.|:|..|.|.:.:|: ....||         .|..|...:|       |..|..||       
 Worm    70 GVGVEPVDACGPVRIAQNHTTRCHNLFAFVSRSNISHPCKFSHQAFMVQNSTYPFRLVIFYNYPG 134

Mouse    86 -RPLGCSWEQTGRRAQRAGATAASVGPEAPGQL-REFED---LEVTVRCD----QPARVLLPHAE 141
             .|:  |.|.|..| .:.......:......:: ::|.|   ..:.||.|    :..|.|:|.  
 Worm   135 QEPI--SMEGTELR-DKVNIPVLMISHACKEEIAKKFSDTAGYRLRVRIDPGYYELFRYLIPF-- 194

Mouse   142 PCPDPECHPVVVASWALARALALAASTLFVLRQLWPWVRGLGSRGTAVK----TQTCQKAQVRTF 202
                     :||..:..|         ||::...   |||...|....|    .:..:|..|:.:
 Worm   195 ---------LVVIVFCFA---------LFLITLC---VRGCVERRKLNKRRLSKRNLKKIPVKKY 238

Mouse   203 TRLS---DLCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAAQRSCPLCKQSV--------- 255
             ||.   |.|||||:.:..||:|:.|||.|.:||.|||.|.:: .::.|||||:.:         
 Worm   239 -RLGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQ-TRKICPLCKRKIGTDSDSECS 301

Mouse   256 ----ASTHDGSTDGSV--------GGEEPPLP-GHRPPIWAIQARL 288
                |||..|..|.:.        .|.|.|:| |....:|:.|..|
 Worm   302 TNDLASTSQGPNDATALYNNADNQSGFELPVPQGQMVDLWSSQEAL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_035613.2 PA_C_RZF_like 19..156 CDD:239038 31/143 (22%)
zf-RING_2 207..252 CDD:290367 22/44 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..279 10/31 (32%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 20/104 (19%)
HRD1 <223..>335 CDD:227568 37/113 (33%)
RING-H2_RNF103 246..291 CDD:319387 23/45 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I6375
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.