DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and rnf128

DIOPT Version :9

Sequence 1:NP_035613.2 Gene:Znrf4 / 20834 MGIID:1341258 Length:327 Species:Mus musculus
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:351 Identity:80/351 - (22%)
Similarity:129/351 - (36%) Gaps:108/351 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 LVLSLSPT------DAQVNLSSVDFLDLPAL-----LGV-----PVDPKRARGYLLV---ARPAD 64
            |:|:||.|      .|.||.|.|  .|....     :||     |::  ||.|.:::   .|...
 Frog    20 LLLNLSLTGADTLWTANVNYSYV--YDNRTYGEEGEIGVFGQDSPIE--RAAGLVVLPKSERTFT 80

Mouse    65 AC---------HAIEGPWPDNHSLDPLVLVRPLGCSWEQTGRRAQRAGATAASV----------- 109
            ||         |...|||       ..:::|..||::.:...||...||.|..|           
 Frog    81 ACKDNTNFSVPHNWNGPW-------IALILRGGGCTFTEKINRAAERGARAVVVYNNGMDNEVFE 138

Mouse   110 ----GPEAP-----GQLREFEDLEVTVRCDQPARVL---LPHAEPCPDPECHPVVVASW------ 156
                |.:..     |.::..|.:||.....|...|:   ..|              .||      
 Frog   139 MSHPGTKDTVAIMIGNIKGNEIVEVIKGGMQVMMVIEVGRKH--------------GSWINHYSI 189

Mouse   157 ---ALARALALAAST---LFVLRQLWPWVRGLGSRGTAVKTQTCQ---KAQVRTFTR-------L 205
               :::..:..||:.   :|...:.|...|....:...:|.:..:   |.|:||..:       .
 Frog   190 FFVSVSFFIVTAATVGYFIFYSARRWRLTRAQNKKMKQLKAEAKKAIGKLQLRTIKQGDKVLGPD 254

Mouse   206 SDLCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAAQRSCPLCK------QSVASTHDGSTD 264
            .|.||:|::.|:..:.::||.|.|.:|..|||||.  ...|:||:||      ..:|...:.:|.
 Frog   255 GDSCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWL--LEHRTCPMCKCDILKSLGIAEDEEETTS 317

Mouse   265 GSVGGEEPPLPGHRPPIWAIQARLRS 290
            .::......|  .|..:..|:...||
 Frog   318 AAIPSVSSEL--QRSTVQTIEEENRS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_035613.2 PA_C_RZF_like 19..156 CDD:239038 41/187 (22%)
zf-RING_2 207..252 CDD:290367 18/44 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..279 3/22 (14%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037 32/146 (22%)
COG5540 <208..302 CDD:227827 28/95 (29%)
RING-H2_RNF128_like 256..304 CDD:319716 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.