DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srebf1 and Mitf

DIOPT Version :9

Sequence 1:NP_035610.1 Gene:Srebf1 / 20787 MGIID:107606 Length:1134 Species:Mus musculus
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:567 Identity:116/567 - (20%)
Similarity:196/567 - (34%) Gaps:163/567 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 EQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSAS 76
            :|.:.:...||||    ::..:.|:.....   ||.::.:.  ::|.|.....|::|.|..|...
  Fly   192 QQMMIQQQTLDTA----MDPKMHLLFGSGQ---GLMESEFI--DSGSTSACGSGSSSLEQMSQLV 247

Mouse    77 LASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGT 141
            ...:|.....|.|:      ..|.....:.:.|.|...|.   :.|.|....::|....|..  .
  Fly   248 QMDNLIDSSSGAKL------KVPLQSIGVDVPPQVLQVST---VLENPTRYHVIQKQKNQVR--Q 301

Mouse   142 LLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPL-----------APAPGVLPT 195
            .|..|| .|.:..|....:..:: .|..:|.|..::.|.....||           ..|..::| 
  Fly   302 YLSESF-KPSMWGSHTSEIKLAN-NSASTGNLQNSSLQKGICDPLERTNRFGCDSAVSAKRIMP- 363

Mouse   196 PALHTQVQSLASQQPLPASAAPRTNTVTSQVQQV-PVVLQPH-----------------FIKADS 242
                       |...:|.|....:......:..: |.||:|:                 ..||:|
  Fly   364 -----------SDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGEPENAHRTAQLGLSKANS 417

Mouse   243 LLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKL---------- 297
             .|::.::.:| .|.:..||:.:......:.|:...||......:.|..:..|.|          
  Fly   418 -SLSSTRSSSG-IVNSIRISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQNDSFNFDKN 480

Mouse   298 ----------PIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLV-VGTEA-- 349
                      |.:...|...||  |:.| :|:..||.||:|.|.:|||:|.||..|: .|::|  
  Fly   481 FNSELSIKQEPQNLTDAEMNAL--AKDR-QKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFY 542

Mouse   350 ------KLNKSAVLRKAIDYIRFLQHS-----NQKLKQENLTLRSAHKSKSLKDLVSACGSGG-- 401
                  :.||..:|:.::|||:.|:|.     ..:|:|..:.|::......:|:|.....|.|  
  Fly   543 EVVRDIRPNKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKELEMQAKSHGIL 607

Mouse   402 ----------------------------------------------GTDVSMEGMK--PEVVETL 418
                                                          |.|.:| ||.  .|.:|..
  Fly   608 LSENHLTSLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQVIDGADGNM-GMNQVDEFMEDC 671

Mouse   419 T------PPPSDAGSPSQSSPLSFGSRASSSGGSD----SEPDSPAF 455
            .      .|...:.|..||:|.|..|:..:||..:    ||.|...|
  Fly   672 KYAVQGGDPMLSSHSHMQSAPQSPSSKTLNSGSFEPKNFSEADESLF 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srebf1NP_035610.1 Transcriptional activation (acidic). /evidence=ECO:0000250|UniProtKB:P36956 1..60 9/47 (19%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:P36956 27..35 0/7 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..73 6/26 (23%)
ERbeta_N 114..210 CDD:289279 19/106 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 6/35 (17%)
Interaction with LMNA. /evidence=ECO:0000269|PubMed:11929849 227..487 75/341 (22%)
HLH 315..372 CDD:238036 25/70 (36%)
Leucine-zipper 367..388 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..468 14/51 (27%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 11/44 (25%)
HLH 505..570 CDD:238036 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.