DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERG and Ets96B

DIOPT Version :9

Sequence 1:NP_001129626.1 Gene:ERG / 2078 HGNCID:3446 Length:486 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:124/281 - (44%) Gaps:90/281 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   198 HLHY-------LRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNT-------------- 241
            |.|:       ..:..|.|||.             :||    .:||.|.:|              
  Fly   361 HSHHGHHGHQQAEQQALTHLTP-------------LHA----ASAFKFSHTAVISSSAVYATPSH 408

Human   242 ----------SVYPE---ATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQ 293
                      |||.:   .|....:..||.|:....:|.....:|:    |.:|:......:.|.
  Fly   409 YAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPS----ALRPNVVDSTTSSDA 469

Human   294 RPQLDPYQILGPTSSRLANPGSGQ--------IQLWQFLLELLSD-SSNSSCITWEGTNGEFKMT 349
            ..:||.:.    .|:.::...:||        :||||||:.||.: ::::|||.|.|...|||:.
  Fly   470 ELRLDQFY----ASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLI 530

Human   350 DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF----------------- 397
            :|:|||||||.:|::|.||||||||:|||||:|.||.||:|:||.|:|                 
  Fly   531 EPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTT 595

Human   398 -----DFHGIAQALQPHPPES 413
                 |.|.:..:|...||.|
  Fly   596 GSGKGDQHQLTLSLAKTPPTS 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERGNP_001129626.1 SAM_PNT-ERG 134..208 CDD:176090 2/16 (13%)
ETS 317..400 CDD:197710 51/113 (45%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.