DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERG and ast-1

DIOPT Version :10

Sequence 1:NP_001129626.1 Gene:ERG / 2078 HGNCID:3446 Length:486 Species:Homo sapiens
Sequence 2:NP_001022326.1 Gene:ast-1 / 173749 WormBaseID:WBGene00020368 Length:377 Species:Caenorhabditis elegans


Alignment Length:143 Identity:105/143 - (73%)
Similarity:112/143 - (78%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   298 DPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERK 362
            ||||||||||..||:.||||.||||||||||||...|..||||||.||||:.|||||||:|||||
 Worm   194 DPYQILGPTSKNLAHSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERK 258

Human   363 SKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS 427
            |||||||||:|||||||||||||.|||||||||||||.|||||||  ||.:|   :|.|  |..|
 Worm   259 SKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQ--PPTAS---HPQD--YFNS 316

Human   428 YHAHPQKMNFVAP 440
             ||    |..:||
 Worm   317 -HA----MGRIAP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERGNP_001129626.1 SAM_PNT-ERG 134..208 CDD:176090
ETS 317..400 CDD:197710 70/82 (85%)
ast-1NP_001022326.1 ETS 213..296 CDD:197710 70/82 (85%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.