DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and HRD1

DIOPT Version :9

Sequence 1:NP_766036.2 Gene:Rnf43 / 207742 MGIID:2442609 Length:784 Species:Mus musculus
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:14/65 - (21%)
Similarity:33/65 - (50%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   264 SSCSSTPVCAICLEEF----------SEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVE 318
            :|.:...:|.||::|.          ::.::.:.:.|.|..|.:|:..|:.:.:|||:|...:.:
Yeast   341 NSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFD 405

Mouse   319  318
            Yeast   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43NP_766036.2 zf-RING_2 270..312 CDD:290367 12/51 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..671
HRD1NP_014630.1 HRD1 5..551 CDD:227568 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.