powered by:
Protein Alignment Rnf43 and HRD1
DIOPT Version :9
Sequence 1: | NP_766036.2 |
Gene: | Rnf43 / 207742 |
MGIID: | 2442609 |
Length: | 784 |
Species: | Mus musculus |
Sequence 2: | NP_014630.1 |
Gene: | HRD1 / 854149 |
SGDID: | S000005373 |
Length: | 551 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 65 |
Identity: | 14/65 - (21%) |
Similarity: | 33/65 - (50%) |
Gaps: | 10/65 - (15%) |
- Green bases have known domain annotations that are detailed below.
Mouse 264 SSCSSTPVCAICLEEF----------SEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVE 318
:|.:...:|.||::|. ::.::.:.:.|.|..|.:|:..|:.:.:|||:|...:.:
Yeast 341 NSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFD 405
Mouse 319 318
Yeast 406 405
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.