DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and rnf150b

DIOPT Version :9

Sequence 1:NP_766036.2 Gene:Rnf43 / 207742 MGIID:2442609 Length:784 Species:Mus musculus
Sequence 2:NP_001017554.1 Gene:rnf150b / 792211 ZFINID:ZDB-GENE-050417-470 Length:419 Species:Danio rerio


Alignment Length:215 Identity:62/215 - (28%)
Similarity:94/215 - (43%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   125 KARMAGERGANAVLFDITEDRSAAEQLQQPLGLTKPVVLIW-----GSDAAKLMEFVYKNRKAYV 184
            |.|.|....|:||:.......:..|.:..|......||.|.     |.:...|||   :|...::
Zfish   119 KIRHAVGHNASAVVIFNVGSSNPNETITMPHQGISDVVAIMIPEPKGRELVLLME---RNITVHM 180

Mouse   185 WIELKEPPAGANYDVWILLTVVGTVFVIILASVLRI------------RCRPHHSRPDPLQQR-- 235
            .|.:    ...|...::..|.|  |||.|...:|.|            |.|..::| |..|:|  
Zfish   181 HITI----GTRNLQKYVSRTSV--VFVSISFIILMIISLAWLVFYYIQRFRYANAR-DRNQRRLG 238

Mouse   236 --TARAISQLATRRYQAGCRRARAEWPDSGSSCSSTPVCAICLEEFSEGQELRVISCLHEFHRTC 298
              ..:|||||..|..:.|.:...:::.:          ||:|:|.:.....:|::.|.|.||:.|
Zfish   239 DAAKKAISQLQVRTIRKGDQETESDFDN----------CAVCIEGYKPNDVVRILPCRHLFHKCC 293

Mouse   299 VDPWLYQHRTCPLCMFNIVE 318
            |||||..|||||:|..||::
Zfish   294 VDPWLVDHRTCPMCKMNILK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43NP_766036.2 zf-RING_2 270..312 CDD:290367 20/41 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..671
rnf150bNP_001017554.1 PA_GRAIL_like 45..182 CDD:239037 16/65 (25%)
UPF0233 <196..>221 CDD:299753 8/26 (31%)
zf-RING_2 265..308 CDD:290367 20/52 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.