DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and mura

DIOPT Version :9

Sequence 1:NP_766036.2 Gene:Rnf43 / 207742 MGIID:2442609 Length:784 Species:Mus musculus
Sequence 2:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster


Alignment Length:158 Identity:47/158 - (29%)
Similarity:66/158 - (41%) Gaps:25/158 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   216 SVLRIRCRPHHSRPDPLQQRTARAISQLATRRYQAGCRRARAEWPDSGSSCSSTPVCAICLEEFS 280
            ::|.:..|...::|..|   |...|.||.:.::.          |:..:...|:  |.:|:.:|.
  Fly  1036 ALLSLAERLGEAKPRGL---TRNEIDQLPSYKFN----------PEVHNGDQSS--CVVCMCDFE 1085

Mouse   281 EGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVEGDSFSQAPAASPSYQEPGRRLHLIRQH 345
            ..|.|||:.|.||||..|||.||..:||||:|..|  ..|.|........|....|....|....
  Fly  1086 LRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN--ASDYFDGVDQQQQSQATAGAAAALSGTS 1148

Mouse   346 PGHAHYHLPSAYLLGPSRTSVARTPRPR 373
            .|       ||.:.|.|..|.| |..|:
  Fly  1149 GG-------SAGVAGTSEASAA-TANPQ 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43NP_766036.2 zf-RING_2 270..312 CDD:290367 21/41 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..407 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..671
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/43 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.