DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and gol

DIOPT Version :9

Sequence 1:NP_766036.2 Gene:Rnf43 / 207742 MGIID:2442609 Length:784 Species:Mus musculus
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:548 Identity:121/548 - (22%)
Similarity:199/548 - (36%) Gaps:130/548 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    71 GVAEVTPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRP-----CLSLASKARMAG 130
            |..:|....|:|:  |.....|.|||....|      .:.....||.|     .::|..:.|...
  Fly    96 GEGKVLNVTGRLI--HITATDNFSDDYACTP------YIRGTLGAPIPDKGETWIALVRRGRCTF 152

Mouse   131 ERGA------NAVLFDITEDRSAAE-QLQQPLGLTKPVVLI-----WGSDAAKLMEFVYK----- 178
            |...      ||....|..|:...: :..|..|.|:.:..:     .|.|.:..::..|.     
  Fly   153 EEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISI 217

Mouse   179 -------------NRKAYVWIELKEPPAGANYDVWILLTVVGTVFVIILASVLRIR---CRPHHS 227
                         ||.:.:::.:.          :|:|.::..|: :|...:.|.|   .:...|
  Fly   218 IEGRRGVRTISSLNRTSVLFVSIS----------FIVLMIISLVW-LIFYYIQRFRYMQAKDQQS 271

Mouse   228 RPDPLQQRTARAISQLATRRYQAGCRRARAEWPDSGSSCSSTPVCAICLEEFSEGQELRVISCLH 292
            |  .|...|.:||.::.|:..:.      ::..|..|.|     ||||:|.:.....:|::.|.|
  Fly   272 R--NLCSVTKKAIMKIPTKTGKF------SDEKDLDSDC-----CAICIEAYKPTDTIRILPCKH 323

Mouse   293 EFHRTCVDPWLYQHRTCPLCMFNIVE--GDSFSQAPAASPSYQ-EPGRRLHLIRQHPGHAHYHLP 354
            |||:.|:||||.:|||||:|..::::  |..|..:..:...|| :|.:.|.|:......|.    
  Fly   324 EFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEARDESAD---- 384

Mouse   355 SAYLLGPSRTSVARTPRPRPFLPSQEPSMGSRHQRLPRTSHLRAPEEQQH----------LAVSP 409
                |..||..|  ...||.|:......:|:|....|    .|.||..|.          :::..
  Fly   385 ----LNRSRDFV--VDFPRVFVLDSGCVVGAREMLFP----CRIPERSQSSLSLRQARDWVSLMS 439

Mouse   410 HPYAQGWGLNRLRCTSQHPAACPVALRRARPHESSGSGESYCTERSGYLADGPASDSSSGPCHGS 474
            :...:..||..:|........  ::.|.:..|..|.|            |||..|....|   |.
  Fly   440 NKLEEQQGLRSMRNDEMQQQL--LSARESARHRRSRS------------ADGRYSTGCFG---GR 487

Mouse   475 SSDSVVNCTDVSLQGIHGSSSTFRSSLSSDFDPLVYCSPEGDLQGKGIQPS----VTSRPR---- 531
            .....|..:.:....:|...:..:.|.||  ..|.:.:.....|.:..|..    ..:|.|    
  Fly   488 QRQPSVLVSSLGQPQLHSEVAQMQRSNSS--QALKHLTDAAHAQSRQRQRESFDFARTRRRFMRR 550

Mouse   532 -----SLDSVVPRGETQVSSHIHYHRHR 554
                 ||.|:..||.|. ::|...||.|
  Fly   551 ESDEISLRSLPRRGATS-AAHRQLHRER 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43NP_766036.2 zf-RING_2 270..312 CDD:290367 21/41 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..407 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..478 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..671 14/52 (27%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 26/128 (20%)
UPF0233 226..>258 CDD:299753 6/42 (14%)
zf-RING_2 301..344 CDD:290367 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.