DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and LOC100536511

DIOPT Version :9

Sequence 1:NP_766036.2 Gene:Rnf43 / 207742 MGIID:2442609 Length:784 Species:Mus musculus
Sequence 2:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio


Alignment Length:277 Identity:68/277 - (24%)
Similarity:119/277 - (42%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    82 LMQSHPLYLC--NASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGANAVLFDITED 144
            |..|.|| .|  |.:...:.:| :|:::|...       | |...|...|...||:||:. ..||
Zfish    82 LPNSDPL-ACSKNTTFTASHQP-WIALIKTGK-------C-SYTKKINAAQREGASAVVI-YNED 135

Mouse   145 RSAAEQLQQPLGLTKPVVLIWGSDAAKLMEF----VYKNRKAYV---WIELK-----EPPAGANY 197
                       |....|:|:..|.|..|:..    :...:.||:   .:::.     ..|.|...
Zfish   136 -----------GTGNDVILMMYSGADDLVAINIGNILGTQIAYLINNGLDVNMTINVATPTGVWK 189

Mouse   198 DVW---ILLTVVG----TVFVIILASVLRIRCRPHHSRPD-PLQQRTARAISQLATRRYQAGCRR 254
            ..|   :..|.:|    |:|......:.|:.......|.. .:::.|.:||.:|..|..:.....
Zfish   190 GTWAYVLSFTFIGITAVTMFYFAFLFMKRMYINRQLRRQQMEIKRETEKAIGKLEVRTLRTNDPE 254

Mouse   255 ARAEWPDSGSSCSSTPVCAICLEEFSEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNI--- 316
            ..::  |:|        |.:|.:.:..|:::.|:.|.|.:|:.|::|||.:|.|||:|.:||   
Zfish   255 VDSD--DTG--------CVVCTDSYQRGEQVTVLPCRHLYHKKCIEPWLLEHPTCPMCKYNILKS 309

Mouse   317 -VEGDSFSQ-APAASPS 331
             :|.||:.| :|::|.|
Zfish   310 SIEEDSYDQPSPSSSSS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43NP_766036.2 zf-RING_2 270..312 CDD:290367 15/41 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..671
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037 27/118 (23%)
zf-rbx1 <188..303 CDD:331150 29/124 (23%)
RING_Ubox 262..308 CDD:327409 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.