DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERF and pnt

DIOPT Version :9

Sequence 1:NP_006485.2 Gene:ERF / 2077 HGNCID:3444 Length:548 Species:Homo sapiens
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:84 Identity:53/84 - (63%)
Similarity:64/84 - (76%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    23 GSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRY 87
            ||..||||.|:||||..:..|..|:|.||..||.:.|||||||.||:||.||:|||:||||.|||
  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRY 670

Human    88 YYNKRILHKTKGKRFTYKF 106
            ||:|.|:|||.|||:.|:|
  Fly   671 YYDKNIIHKTAGKRYVYRF 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERFNP_006485.2 ETS 26..111 CDD:197710 51/81 (63%)
Atrophin-1 <126..383 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..548
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 51/81 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.