DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9d and nec

DIOPT Version :9

Sequence 1:NP_035590.1 Gene:Serpinb9d / 20726 MGIID:894667 Length:377 Species:Mus musculus
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:376 Identity:104/376 - (27%)
Similarity:178/376 - (47%) Gaps:23/376 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 FAIHLLKVLCQDNPSENVCFSPMSISSALAMVLLGAKGNTVTQICQALHLNPDE-DVHQGFQLLL 74
            |:..|.|.:.:....:||.|||.|:.:.||::...:.|.|..::.:|...:.:. .|.|.|:.::
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174

Mouse    75 HNLNKPNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVSK 139
            .  .|.:.:...||:|.:::.......:....:...|||.|...:....:.|:::...||.||..
  Fly   175 K--YKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMD 237

Mouse   140 QTNGKIPDLLPKDSIDSQTRLILANALYFQGTWYKLFEKDSTKEMPFKINKKETRPVQMMWQEDR 204
            .|..||.||:....:|.||:.:|.||:||||.|...|....|....|:........|.||:.:|.
  Fly   238 TTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDV 302

Mouse   205 FYHAYVKEIQAQVLVMPYEGIDLSFVVLLPDKGVDISKVENNLTFEKLTAWTKPDF-MNGI---- 264
            :..|.:.|:.|..|.:.|:....|.::|||::...:.|:...|        ::|:| :|.:    
  Fly   303 YGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQL--------SRPEFDLNRVAHRL 359

Mouse   265 ---ELHVYLPKFQLQEDYDMNSLLQHLGILDVFDGSKADLSGMSTKENLCLSNFVHKCVVEVNEE 326
               .:.|.|||||.:.:.||...|::||:..:|..:......|.  :.:.:|..:.|..:.|.|.
  Fly   360 RRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD--QPVRVSKILQKAYINVGEA 422

Mouse   327 GTEAAAATAGKTIQCCLGSYPQTFCADHPFLFFIMHSTTNSILFCGRFSSP 377
            ||||:||:..|.:...|...|..|.|:.||:|.:  .|..|:||.|....|
  Fly   423 GTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9dNP_035590.1 serpin 1..377 CDD:393296 103/374 (28%)
necNP_524851.1 SERPIN 108..468 CDD:238101 103/371 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.