DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb8 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:367 Identity:124/367 - (33%)
Similarity:200/367 - (54%) Gaps:22/367 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 LLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGD--VHQSFQTLLAEI 77
            :.::||:...::||...|:|:.:.|:||::||:|:||.::...|||.....  |...:..||.::
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85

Mouse    78 NKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEG--CRKHINDWVSEKT 140
            ...:...:||.|.|::..:.......:..:..:.:::..|.:|.   |.|  ..:.||.||.::|
  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL---TNGPVAAERINQWVLDQT 147

Mouse   141 EGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEKKT-VQMMFKHAKFK 204
            .|||..::.||::....|.:||||:||||:|:::||...||...|:....|.. ||||.:...|:
  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212

Mouse   205 MGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFLP 269
            ..:..:::.||:.|||....|||.|.||.|...|:.:|     ||:..:..|  |...:|.:.||
  Fly   213 ANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYLKLP 270

Mouse   270 RLKLEESYDLETVLQNLGMTDAFEETRADFSGM-TTKKNVPVSKVAHKCFVEVNEEGTEAAAATA 333
            :.|:|...:|:..|:.||:.:.|.: ::|.||: ..|....||:|:||.|:||||||.|||.||:
  Fly   271 KFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATS 334

Mouse   334 V-IRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP 374
            | :.|.....|  ...|||||.|.|  ...::|.|.||..||
  Fly   335 VAVTNRAGFST--FLMADHPFAFVI--RDANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 122/365 (33%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 121/362 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.