DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9 and nec

DIOPT Version :9

Sequence 1:NP_033282.1 Gene:Serpinb9 / 20723 MGIID:106603 Length:374 Species:Mus musculus
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:369 Identity:106/369 - (28%)
Similarity:179/369 - (48%) Gaps:12/369 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 FAIHLLKMLCQSNPSKNVCYSPASISSALAMVLLGAKGQTAVQISQALGLNKEE-GIHQGFQLLL 74
            |:..|.|.:.:|...:||.:||.|:.:.||::...:.|:|..::.:|...:|.. .:.|.|:.::
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174

Mouse    75 RKLNKPDRKYSLRVANRLFADKTCEVLQTFKESSLHFYDSEMEQLSFAEEAEVSRQHINTWVSKQ 139
             |..|......|.:|.:::.::....:....:....||.|...:....:.|:.:...||.||...
  Fly   175 -KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDT 238

Mouse   140 TEGKIPELLSGGSVDSETRLVLINALYFKGKWHQPFNKEYTMDMPFKINKDEKRPVQMMCREDTY 204
            |..||.:|::...||.:|:.:|:||:||:|:|...|....|....|:........|.||..:|.|
  Fly   239 TRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVY 303

Mouse   205 NLAYVKEVQAQVLVMPYEGMELSLVVLLPDEGVDLSKVENNLTFEKLTAWMEADFMKSTDVEVFL 269
            .||.:.|:.|..|.:.|:....|:::|||:|...|.|:...|:..:......|..::...|.|.|
  Fly   304 GLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVRL 368

Mouse   270 PKFKLQEDYDMESLFQRLGVVDVFQEDKADLSGM-SPERNLCVSKFVHQSVVEINEEGTEAAAAS 333
            |||:.:.:.||....:.|||..:|..:......| .|.|   |||.:.::.:.:.|.||||:|||
  Fly   369 PKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPVR---VSKILQKAYINVGEAGTEASAAS 430

Mouse   334 AIIEFCCASSVP---TFCADHPFLFFIRHNKANSILFCGRFSSP 374
             ..:|...|..|   .|.|:.||:|.:|  ...|:||.|....|
  Fly   431 -YAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9NP_033282.1 serpin 1..374 CDD:393296 105/367 (29%)
necNP_524851.1 SERPIN 108..468 CDD:238101 105/364 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.