DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3m and Spn88Eb

DIOPT Version :9

Sequence 1:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:402 Identity:102/402 - (25%)
Similarity:181/402 - (45%) Gaps:55/402 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    53 DFAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETSEADIHQGF 117
            ||:.:|.|::....|..|:.|||.|...||.|....:...|..|:.:.|........:..:    
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVL---- 100

Mouse   118 GHLLQRLSQPEDQ-------DQINIGNAMFIEKDLQILAEF----HEKTRALYQTEAFTADFQ-Q 170
              :...|:|.:|:       .:::..|.:|:::.:.:..:|    :..|:.|        ||: .
  Fly   101 --VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKEL--------DFKND 155

Mouse   171 PTEATKLINDYVSNQTQGMIKKLIS--ELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDE 233
            |....|.|||:::::|...|:.::|  |:...|::||.|..|.||:|...|..::|....|:::|
  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220

Mouse   234 KRSVKVPMMKMKFLTTRHFR---DEELSCSVLELKY----------------TGNASALFILPDQ 279
            :....|.||.    .|..|:   ||.|...:::|.|                ..:.|.:.|||:.
  Fly   221 REQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281

Mouse   280 GR--MQQVEASLQPETLRKWWKSLKTRKIGELYLPKFSISTDYNLKDILPELGIKEIFSKQADLS 342
            .:  :.:|.:.|..::::||::....:|| ||.||||.......|..||..:|:..:|::.|...
  Fly   282 NKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345

Mouse   343 GITGTK-DLSVSQVVHKAVLDVAETGTEAAAATGFIFGFRSRRLQTMTVQFNRPFLMVISHTGVQ 406
            .:|... .|.:....|.|.:.|.|.|:.|||||..:....||:........|.||:.:|....|.
  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410

Mouse   407 TTLFMAKVTNPK 418
            |.||....::|:
  Fly   411 TILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 99/396 (25%)
RCL 367..392 8/24 (33%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/396 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.