DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3n and Spn42Dd

DIOPT Version :9

Sequence 1:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:380 Identity:117/380 - (30%)
Similarity:184/380 - (48%) Gaps:22/380 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    45 LTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETS 109
            |.:.|:....:..:|:.|...:.::|:|.||:||...|:::.:||:|:|.:|:...|... :|..
  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDK 71

Mouse   110 EADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQA 174
            || :...:|.||..|...::...:...:.:::..:..:...:....|..:::||.:........|
  Fly    72 EA-VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVA 135

Mouse   175 KKLINDYVRKQTQGMIKELV--SDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPV 237
            .:.||.:|..||.|.||.::  ..:......:|||.||||.:|:..|||..|..|.|.....:.|
  Fly   136 AERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200

Mouse   238 IVPMMS-MEDLTTPYFRDEELFCTVVELKY-TGNASAMFILPDQGKMQQVEASLQPETLRKWKNS 300
            .|.||: |......||||  |...|:||.| ..|.|....||     ::||.....|  .|....
  Fly   201 PVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALE--EKIVGF 256

Mouse   301 LKPRMIDE--LHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKD-LRVSQVVHKAVLD 362
            .:|.:..|  |.||||.|.....|::.|.||||||:|:.::|||.:...|. .:||||.|||.|:
  Fly   257 ARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLE 321

Mouse   363 VAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANP 417
            |.|.|.|||.||.|.....:.  :...:..:.||..:|.|..|  ..|..::.:|
  Fly   322 VNEEGAEAAGATSVAVTNRAG--FSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 117/380 (31%)
RCL 367..392 7/24 (29%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 114/367 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.