DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3n and Spn88Eb

DIOPT Version :9

Sequence 1:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:418 Identity:103/418 - (24%)
Similarity:181/418 - (43%) Gaps:56/418 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    42 LDSLTLASIN---------TDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEI 97
            ||...|:.:|         .||:.:|.|::....|..|:.|||.|...||.:....:...|..|:
  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84

Mouse    98 LEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQ-------VQISTGSALFIEKRQQILTEFQEKA 155
            .:.|........:..:      :...|.|.:|:       :::|:.:.:|:::...:..:|.   
  Fly    85 AQALNLGWALNKQQVL------VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN--- 140

Mouse   156 RALYQAEAFTADFQ-QPRQAKKLINDYVRKQTQGMIKELVS--DLDKRTLMVLVNYIYFKAKWKV 217
            ..||.|.. ..||: .|....|.|||::..:|...|::::|  ::...|::||.|..|.|.:|..
  Fly   141 TLLYGATK-ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLS 204

Mouse   218 PFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFR---DEELFCTVVELKY------------- 266
            .|...:|....|:..:|...:|.||.    .|..|:   ||.|...:::|.|             
  Fly   205 QFKVEETALKPFFINEREQEMVYMMH----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHIST 265

Mouse   267 ---TGNASAMFILPDQGK--MQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVL 326
               ..:.|.:.|||:..|  :.:|.:.|..::::||.....|:.| ||.||||.......|..:|
  Fly   266 PESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPIL 329

Mouse   327 SKLGIREVFSTQADLSAITGTK-DLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTV 390
            |.:|:..:|:..|....:|... .|.:....|.|.:.|.|.|:.|||||.:.....|.:..|...
  Fly   330 SLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKF 394

Mouse   391 YFNRPFLIMIFDTETEIAPFIAKIANPK 418
            ..|.||:.:|:|.:.:...|....::|:
  Fly   395 NCNHPFVFLIYDEKVDTILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 102/416 (25%)
RCL 367..392 8/24 (33%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/395 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.