DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3g and Spn42Dd

DIOPT Version :9

Sequence 1:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:389 Identity:126/389 - (32%)
Similarity:190/389 - (48%) Gaps:36/389 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 VTSVDSLTLVSSNTDFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKF 93
            ||||...|        :..:|:.|...:.::|:|.||.||.|.|:::.:||:.:|.||:...|..
  Fly    10 VTSVACQT--------SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL 66

Mouse    94 NLTETPEPDIHQ-GFRY---LLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAF 154
                 |..|... ..||   |.||..|....: :...:.:::.....:...:....|..:::||.
  Fly    67 -----PSEDKEAVAARYGALLNDLQGQEEGPI-LKLANRIYVNDQYSLNQNYNLAVREPFKSEAE 125

Mouse   155 TADFQQPLKATKLINDYVSNHTQGKIKQLI--SGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKS 217
            :........|.:.||.:|.:.|.||||.:|  ..:...:..:|||.|||||:|::.|||..|..|
  Fly   126 SISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAS 190

Mouse   218 EFYLDEKRSVIVSMM-KTGYLTTPYFRDEELSCTVVELKY-TGNASAMFILPDQGRMQQVEA-SL 279
            .|.:...:||.|.|| :.|.....||||  |...|:||.| ..|.|....||     ::||. |.
  Fly   191 TFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSA 248

Mouse   280 QPETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKD-LRVS 343
            ..|.:..:...|..:.:: |:||||.|.....|:..|.:|||||:|:.::|||.:...|. .:||
  Fly   249 LEEKIVGFARPLVAKEVY-LKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVS 312

Mouse   344 QVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKAHIALFMAKVTNP 407
            ||.|||.|:|.|:|.|||.||.:|.........||  ..:.||..:|.|  |:...|..:|.:|
  Fly   313 QVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFL--MADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 120/370 (32%)
RCL 357..382 9/24 (38%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 120/378 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.