DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3k and Spn42Dd

DIOPT Version :9

Sequence 1:NP_035588.2 Gene:Serpina3k / 20714 MGIID:98377 Length:418 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:382 Identity:128/382 - (33%)
Similarity:200/382 - (52%) Gaps:27/382 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 LTLASVNTDFAFSLYKKLALKNQDKNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETP 110
            |.:.||....:..:|:.|:..:.::|:|.||:||...|::|.:||:|.|.:|:...|... :|..
  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDK 71

Mouse   111 EADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEA 175
            || :...:|.||..|...|:...:.:.|.:::.....:...::...|..:::||.:........|
  Fly    72 EA-VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVA 135

Mouse   176 KNLINDYVSNQTQGMIKKLISELDDGTL-----MVLVNYIYFKGKWKISFDPQDTFESEFYLDEK 235
            ...||.:|.:||.|.||.:|   |.|::     .:|||.|||||:|:..|||..|..|.|.:...
  Fly   136 AERINQWVLDQTSGKIKGMI---DPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTAN 197

Mouse   236 RSVKVPMM-KMKLLTARHFRDEELSCSVLELKY-TGNASALLILPDQGRMQQVEA-SLQPETLRK 297
            :||.|.|| :|....|.:|||  |...|:||.| ..|.|..:.||     ::||. |...|.:..
  Fly   198 KSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVG 255

Mouse   298 WRKTLFSSQIEELNLPKFSIASDYRLE-EDVLPEMGIKEVFTEQADLSGITEAKK-LSVSQVVHK 360
            :.:.|.:.:: .|.||||.|  ::|.| ::.|.::||:|:||:::||||:...|. ..||||.||
  Fly   256 FARPLVAKEV-YLKLPKFKI--EFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHK 317

Mouse   361 AVLDVAETGTEAAAATGVIGGIRKAVLPAVCFNRPFLIVIYHTSAQSILFMAKVNNP 417
            |.|:|.|.|.|||.||.|....|......:..:.||..||  ..|.:|.|..:|.:|
  Fly   318 AFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3kNP_035588.2 SERPIN 57..417 CDD:214513 124/369 (34%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 123/369 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.