DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9f and Spn42Dd

DIOPT Version :9

Sequence 1:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:377 Identity:126/377 - (33%)
Similarity:204/377 - (54%) Gaps:39/377 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 LLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDED---VHQGFQLLLHN 76
            :.::|.:.:.::|:..||:||.:.|:||.:||:|.||.::..||.| |.||   |...:..||::
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL-PSEDKEAVAARYGALLND 84

Mouse    77 LNKQNNQKYCLRMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAK---AAEESRQHINMWVS 138
            |..| .:...|::|||::|.:...|...:..:..:.:.||.|.:|...   |||    .||.||.
  Fly    85 LQGQ-EEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE----RINQWVL 144

Mouse   139 KQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWRED 203
            .||:|||..::...|:.|..:.:|.||:||.|.|..:|:..:|:...|::...::.|||||.:..
  Fly   145 DQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMG 209

Mouse   204 TLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHV 268
            |....|.:::.|||:.:||...:|:..:.||.|...:|.:|     ||:..:.:|  :...|.::
  Fly   210 TFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYL 267

Mouse   269 YLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGM-STKENLCLSEFVHKCVVEVNEEGTEAAA 332
            .||||:::...::...|:.|||..:|. .|:||||: :.|....:|:..||..:||||||.|||.
  Fly   268 KLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAG 331

Mouse   333 ASAVEF-------IFLCLGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377
            |::|..       .||         .|||||.|.|..:  |:|.|.||..||
  Fly   332 ATSVAVTNRAGFSTFL---------MADHPFAFVIRDA--NTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 124/375 (33%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 123/372 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.