DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb6b and Spn88Eb

DIOPT Version :9

Sequence 1:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:395 Identity:119/395 - (30%)
Similarity:191/395 - (48%) Gaps:28/395 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 LLEANATFALNLLKTLGE-DSSRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGKGG 67
            :.:....|:|.|:|.:.| ..|.|:.|||.|..:||.:.:..:...|..::||||:|.....|..
  Fly    34 IFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQ 98

Mouse    68 RDVHQGFQSLLTETNKTGTQYVLRTANRLFGEKTFDILASFKDSCRKFYEAEMEELDFKGATEQS 132
            ..|.........|.....:...|.:|||:|.::|.::...|.   ...|.| .:|||||...|..
  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGA-TKELDFKNDPETG 159

Mouse   133 RQHINAWVAKKTEDKITELLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMPFNVTKDVVK 197
            .:.||.|:|.||.::|.::|||..:..:|.|||.||.|.||.|..||..|:|...||.:.:...:
  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224

Mouse   198 PVQMMFQKSTFKMTYVEEISTNILLLPY---------------VGNELNMIIMLPDEH-IELSMV 246
            .|.||.:...||||..|.:.:.|:.|||               ..::::|||:||:.: |.|:.|
  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRV 289

Mouse   247 EKEITYKKFIEWTRLDKMEEEEVEVFLPKFKLEENYDMKDVLCRLGMTDAFEEGMADFSGI-ASK 310
            ...:......:|  .::...:::|:.||||:.|:..::..:|..:|:...|... |.|..: |..
  Fly   290 ISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRN-ATFGDLTADP 351

Mouse   311 EGLFLSKVIHKSFVEVNEEGTEAAAATAANIGFRCMVP---YFCANHPFLFFIQHSRTSGIVFCG 372
            ..|.:....|.:.::|:|.|:.|||||...:......|   .|..||||:|.|...:...|:|.|
  Fly   352 ISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416

Mouse   373 RFSSP 377
            .:|.|
  Fly   417 VYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 118/393 (30%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 117/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.