DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9c and Spn42Dd

DIOPT Version :9

Sequence 1:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:368 Identity:120/368 - (32%)
Similarity:191/368 - (51%) Gaps:22/368 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    42 LLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGL----NTAIDIHQSFLWILN 102
            :.::|..::.::|:..||::|.:.|:|..:|.:|:|..::..|:||    ..|:......|  ||
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGAL--LN 83

Mouse   103 ILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINTWVCKNT 167
            .|:........::|||::..:.......:.....:.:..|.|.:..|..| .|...||.||...|
  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-VAAERINQWVLDQT 147

Mouse   168 KGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERPVQMMFQEDMFK 232
            .|||..::..||:.|:.:.:||||:||||:|..:||...||...|::..::..|||||.|...|:
  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212

Mouse   233 LAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDYLKTTKVLVFLP 297
            ..|..::..||:.|||....||:.:.||.:...||.:|     ||:..:.:|  |...:|.:.||
  Fly   213 ANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYLKLP 270

Mouse   298 KFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPER-GLCVSKFIQKCVVEVNEEGTEATAATA 361
            |||:|...:::...:.||:.::|. .|:|||.:..:: |..||:...|..:||||||.||..|| 
  Fly   271 KFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGAT- 333

Mouse   362 DDTVCSAETHDGQTF-CADHPFLFFIRHNKTNSILFCGRFSFP 403
              :|.........|| .|||||.|.||  ..|:|.|.||...|
  Fly   334 --SVAVTNRAGFSTFLMADHPFAFVIR--DANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 119/366 (33%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 118/363 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.