DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9c and Spn88Eb

DIOPT Version :9

Sequence 1:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:412 Identity:114/412 - (27%)
Similarity:189/412 - (45%) Gaps:46/412 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 EPPFLN---IVYEANGTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAI 85
            |..|||   .:::....|::.|::.:....||.|:.:||.:..:||.:........||.::::|:
  Fly    24 ELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL 88

Mouse    86 GLNTAIDIHQSFLWILNILKKPTRKYTFR---------MANRLFAENTCEFLPTFKEPCLQFYHW 141
            .|..|::..|    :|.......|:..||         .|||:|.:.|......|.    ...:.
  Fly    89 NLGWALNKQQ----VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN----TLLYG 145

Mouse   142 EMEHLPFTKAPEEARNHINTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKS 206
            ..:.|.|...||.....||.|:...|..:|.::|||..:...|.|||.||.|.||:|..||.::.
  Fly   146 ATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEE 210

Mouse   207 TRKMPFKINKDEERPVQMMFQEDMFKLAYVNEVQVQVLVLP----YKGKE-----------LSLV 256
            |...||.||:.|:..|.||.:...||:.....:|.|::.||    ||.||           :|::
  Fly   211 TALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMI 275

Mouse   257 VLLPDDG-VELSKVEGNLTFEKLSAWTK---PDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVG 317
            ::||:.. :.|::|...|..:.:..|.:   |.     |:.:.||||:.|...::..|...:||.
  Fly   276 IILPNSNKISLNRVISRLNADSVKKWFERALPQ-----KIELSLPKFQFEQRLELTPILSLMGVN 335

Mouse   318 DIFQGGKADLSEMSPER-GLCVSKFIQKCVVEVNEEGTEATAATADDTVCSAETHDGQTFCADHP 381
            .:|. ..|...:::.:. .|.:........::|:|.|:.|.|||......|:...|...|..:||
  Fly   336 TMFT-RNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHP 399

Mouse   382 FLFFIRHNKTNSILFCGRFSFP 403
            |:|.|...|.::|||.|.:|.|
  Fly   400 FVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 111/406 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 108/394 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.