DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb9b and nec

DIOPT Version :9

Sequence 1:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:381 Identity:110/381 - (28%)
Similarity:176/381 - (46%) Gaps:33/381 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 FAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALG--LKKEKGIHQGF--- 70
            |:..|.|.:.:|...:||.|||.|:.:.||:: .||.:....:..|..|  .|....:.|.|   
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTFRELQKAGEFSKNAMAVAQDFESV 173

Mouse    71 LKLLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESRQCINTW 135
            :|..:.|...|    |.:|.:::.::....:....:...:||.|...:....:.|.::...||.|
  Fly   174 IKYKKHLEGAD----LTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAW 234

Mouse   136 VSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRPVQMMCQ 200
            |...|..||.:|:....|:.||:.:||||:||:|.|..:|....|....|.........|.||..
  Fly   235 VMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFN 299

Mouse   201 TDTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVENDLTFEKLIAWTKPDI------ 259
            .|.:..|.:.||.|..|.:.|:....|:::|||.:...|.|:...|        ::|:.      
  Fly   300 DDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQL--------SRPEFDLNRVA 356

Mouse   260 --MWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAM-SPERNLCLSKFIHKSVVE 321
              :....|.|.||||:.:.:.:|...|:.||:..:|.........| .|.|   :||.:.|:.:.
  Fly   357 HRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPVR---VSKILQKAYIN 418

Mouse   322 VNEEGTEAAAASSAEGIIPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCGRFSSP 377
            |.|.||||:|||.|: .:||.|...|:.|.|:.||:|.:|  ...|:||.|....|
  Fly   419 VGEAGTEASAASYAK-FVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 109/379 (29%)
necNP_524851.1 SERPIN 108..468 CDD:238101 109/376 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.