DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1d and Spn88Eb

DIOPT Version :9

Sequence 1:NP_033272.1 Gene:Serpina1d / 20703 MGIID:891968 Length:413 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:456 Identity:107/456 - (23%)
Similarity:186/456 - (40%) Gaps:88/456 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 SWSLLLLAGLCCLVP------------SFLAEDVQETDTSQKDQSPASHEIATNLGDFALRLYRE 58
            ::||:|||    |:|            |||.|..|               |.....||:|.|.::
  Fly     3 TFSLVLLA----LLPVVTIAALDKPELSFLNEFSQ---------------IFKGERDFSLALMKQ 48

Mouse    59 LVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTL-N 122
            :.....:.|:||||.|...|..:....|...|..::.:.|.....      ::|....:..|| .
  Fly    49 IREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA------LNKQQVLVSYTLAQ 107

Mouse   123 RPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFSVNFAESEEAK 172
            |.|      |.::||:.|.:||:..:.:..||..         :.||            :.|...
  Fly   108 RQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN------------DPETGL 160

Mouse   173 KVINDFVEKGTQGKIVEAV--KKLDQDTVFALANYILFKGKWKQPFDPENTEEAEFHVDESTTVK 235
            |.|||::...|..:|.:.:  :::...|:..|||....||:|...|..|.|....|.::|.....
  Fly   161 KEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEM 225

Mouse   236 VPMMTLSGMLDVHHCSMLSSWVLLMDY----------------AGNTTAVFLLPDDGK--MQHLE 282
            |.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:..|  :..:.
  Fly   226 VYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVI 290

Mouse   283 QTLNKELISQFLLNRRRSDAQIHIPRLSISGNYNLKTLMSPLGITRIFNNGADLSGITEENAPLK 347
            ..||.:.:.::.........::.:|:........|..::|.:|:..:|...|....:|.:...|.
  Fly   291 SRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLV 355

Mouse   348 LSKAVHKAVLTIDETGTEAAAATVLQVATYS-MPPIVRF--DHPFLFIIFEEHTQSPIFVGKVVD 409
            :..|.|.|.:.:||.|:.|||||:|.|:..| .|...:|  :|||:|:|::|...:.:|.|...|
  Fly   356 IDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSD 420

Mouse   410 P 410
            |
  Fly   421 P 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1dNP_033272.1 SERPIN 53..410 CDD:214513 90/395 (23%)
RCL 368..387 8/21 (38%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.