DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1c and Spn88Eb

DIOPT Version :9

Sequence 1:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:401 Identity:95/401 - (23%)
Similarity:172/401 - (42%) Gaps:59/401 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    50 DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSF 114
            ||:::|.:::.....:.|:||||.|...|..:....|...|..::.:.|.....      ::|..
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA------LNKQQ 98

Mouse   115 QHLLQTL-NRPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFSV 163
            ..:..|| .|.|      |.::||:.|.:||:..:.:..||..         :.||         
  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN--------- 154

Mouse   164 NFAESEEAKKVINDFVEKGTQGKIAEAV--KKLDQDTVFALANYILFKGKWKKPFDPENTEEAEF 226
               :.|...|.|||::...|..:|.:.:  :::...|:..|||....||:|...|..|.|....|
  Fly   155 ---DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216

Mouse   227 HVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDY----------------AGNATAVFLLPDD 275
            .::|.....|.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:.
  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281

Mouse   276 GKMQHLEQTLSK---ELISKFLLKRPRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLS 337
            .|:. |.:.:|:   :.:.|:..:...:..::..|:........|..::|.:|:..:|...|...
  Fly   282 NKIS-LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345

Mouse   338 GITEENAPLKLSQAVHKAVLTMDETGTEAAAATVLLAVPYS-MPPIVRF--DHPFLFIIFEEHTQ 399
            .:|.:...|.:..|.|.|.:.:||.|:.|||||:||....| .|...:|  :|||:|:|::|...
  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410

Mouse   400 SPLFVGKVVDP 410
            :.||.|...||
  Fly   411 TILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 91/396 (23%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 93/396 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.