DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1b and Spn42Dd

DIOPT Version :9

Sequence 1:NP_033270.3 Gene:Serpina1b / 20701 MGIID:891970 Length:413 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:362 Identity:104/362 - (28%)
Similarity:172/362 - (47%) Gaps:21/362 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    58 ELVHQSNTS-NIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTL 121
            :|:.:|:|: |:..|||||.|..:|:.:|::|.|..::...|  .|....:..:...:..||..|
  Fly    23 QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDKEAVAARYGALLNDL 85

Mouse   122 NRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGK 186
            ...:....|...|.::||:...|.:.:....:..:::|..|::......|.:.||.:|...|.||
  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGK 150

Mouse   187 IVEAVK--ELDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDKSTTVKVPMMMLSGMLDVHH 249
            |...:.  .:..|....|.|.|.|||:|:..|||..|..:.|.|..:.:|.|.||...|....::
  Fly   151 IKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANY 215

Mouse   250 CSILSSWVLLMDYA-GNASAVFLLPEDGK-MQHLEQTL---NKELISKILLNRRRRLVQIHIPRL 309
            ...|.:.|:.:.|. .|.|....||.:.: :..||:.:   .:.|::|        .|.:.:|:.
  Fly   216 FRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVAK--------EVYLKLPKF 272

Mouse   310 SISGDYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSKAVHKAVLTIDETGTEAAAAT-VFE 373
            .|.....||..:..|||..:|.:.:||||:..:.:..|:|:..|||.|.::|.|.|||.|| |..
  Fly   273 KIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAV 337

Mouse   374 AVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDP 410
            .........|..||||.|:|.:.:|  ..|.|:||.|
  Fly   338 TNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1bNP_033270.3 SERPIN 53..410 CDD:214513 103/360 (29%)
RCL 368..387 4/19 (21%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 101/357 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.